SCOP 1.55: Domain d1dxp.2: 1dxp B:,D:

Lineage for d1dxp.2 (1dxp B:,D:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (2 proteins)

6. Protein NS3 protease [50600] (2 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries)

8. Domain d1dxp.2: 1dxp B:,D: [26405]

Details for d1dxp.2

PDB Entry: 1dxp, 2.4 Å

PDB Description: inhibition of the hepatitis c virus ns3/4a protease. the crystal structures of two protease-inhibitor complexes (apo structure)

SCOP Domain Sequences for d1dxp.2:

Sequence; same for both SEQRES and ATOM records:

>g1dxp.2 b.47.1.3 (B:,D:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmXgsvv
ivgriils

Timeline for d1dxp.2:

• d1dxp.2 appears in SCOP 1.57
  
• d1dxp.2 appears in the current release, SCOPe 2.08