Lineage for d1dxp.1 (1dxp A:,C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 61083Family b.47.1.3: Viral proteases [50596] (2 proteins)
  6. 61084Protein NS3 protease [50600] (2 species)
  7. 61089Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries)
  8. 61096Domain d1dxp.1: 1dxp A:,C: [26404]

Details for d1dxp.1

PDB Entry: 1dxp (more details), 2.4 Å

PDB Description: inhibition of the hepatitis c virus ns3/4a protease. the crystal structures of two protease-inhibitor complexes (apo structure)

SCOP Domain Sequences for d1dxp.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dxp.1 b.47.1.3 (A:,C:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmXgsvv
ivgriils

SCOP Domain Coordinates for d1dxp.1:

Click to download the PDB-style file with coordinates for d1dxp.1.
(The format of our PDB-style files is described here.)

Timeline for d1dxp.1: