SCOP 1.63: Domain d1jxp.2: 1jxp B:,D:

Lineage for d1jxp.2 (1jxp B:,D:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (4 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein NS3 protease [50600] (2 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries)

8. Domain d1jxp.2: 1jxp B:,D: [26403]
   complexed with zn

Details for d1jxp.2

PDB Entry: 1jxp, 2.2 Å

PDB Description: bk strain hepatitis c virus (hcv) ns3-ns4a

SCOP Domain Sequences for d1jxp.2:

Sequence; same for both SEQRES and ATOM records:

>g1jxp.2 b.47.1.3 (B:,D:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
itaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsk
tlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgds
rgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmXgs
vvivgriils

Timeline for d1jxp.2:

• d1jxp.2 first appeared (with stable ids) in SCOP 1.55
  
• d1jxp.2 appears in SCOP 1.61
  
• d1jxp.2 appears in SCOP 1.65
  
• d1jxp.2 appears in the current release, SCOPe 2.08