Lineage for d4w9ca_ (4w9c A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177238Protein Elongin B [54246] (2 species)
  7. 2177239Species Human (Homo sapiens) [TaxId:9606] [54247] (38 PDB entries)
  8. 2177272Domain d4w9ca_: 4w9c A: [264020]
    Other proteins in same PDB: d4w9cb_, d4w9cc_, d4w9ce_, d4w9cf_, d4w9ch_, d4w9ci_, d4w9ck1, d4w9ck2, d4w9cl_
    automated match to d1lqba_
    complexed with 3jg

Details for d4w9ca_

PDB Entry: 4w9c (more details), 2.2 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-(3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(oxazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 2)
PDB Compounds: (A:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4w9ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w9ca_ d.15.1.1 (A:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d4w9ca_:

Click to download the PDB-style file with coordinates for d4w9ca_.
(The format of our PDB-style files is described here.)

Timeline for d4w9ca_: