Lineage for d1jxp.1 (1jxp A:,C:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 803501Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 803502Protein NS3 protease [50600] (4 species)
  7. 803511Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (14 PDB entries)
    Uniprot P27958 1027-1206,1678-1669
    Uniprot P26662 1029-1202,1677-1689
    Uniprot O36579 1054-1207
  8. 803522Domain d1jxp.1: 1jxp A:,C: [26402]

Details for d1jxp.1

PDB Entry: 1jxp (more details), 2.2 Å

PDB Description: bk strain hepatitis c virus (hcv) ns3-ns4a
PDB Compounds: (A:) ns3 serine protease, (C:) ns4a

SCOP Domain Sequences for d1jxp.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1jxp.1 b.47.1.3 (A:,C:) NS3 protease {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
itaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsk
tlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgds
rgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmXgs
vvivgriils

SCOP Domain Coordinates for d1jxp.1:

Click to download the PDB-style file with coordinates for d1jxp.1.
(The format of our PDB-style files is described here.)

Timeline for d1jxp.1: