Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Brucella suis [TaxId:520488] [260277] (1 PDB entry) |
Domain d4w91e_: 4w91 E: [264015] automated match to d4w91b_ complexed with cl |
PDB Entry: 4w91 (more details), 2.45 Å
SCOPe Domain Sequences for d4w91e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w91e_ c.67.1.0 (E:) automated matches {Brucella suis [TaxId: 520488]} ydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavthayaneyanvhrglhfls naatdayeksretvrrflnagsvdeivftknateaintvaygygmpfigegdeillsime hhsnivpwhfirerqgaklvftpvddngvfhieefekrlsertklvaithmsntlgtvvp ikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftghkvygpsgigvlygraqm lekmrpfqgggemieevteenvtynhpphrfeagtppivqaiglgaaleymekigrhail aheadlrdyaherlgrinslrifgnapdkgaiisfalegihahdvsmvidragvavragt hcaqpllkrfgvtstcrasfalyntraevdalaealekarkffg
Timeline for d4w91e_: