Lineage for d1dy9.2 (1dy9 B:,D:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298675Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 298676Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 299596Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 299597Protein NS3 protease [50600] (2 species)
  7. 299602Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries)
  8. 299604Domain d1dy9.2: 1dy9 B:,D: [26401]
    complexed with boc, fki, zn

Details for d1dy9.2

PDB Entry: 1dy9 (more details), 2.1 Å

PDB Description: inhibition of the hepatitis c virus ns3/4a protease. the crystal structures of two protease-inhibitor complexes (inhibitor i)

SCOP Domain Sequences for d1dy9.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dy9.2 b.47.1.3 (B:,D:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmXgsvv
ivgriils

SCOP Domain Coordinates for d1dy9.2:

Click to download the PDB-style file with coordinates for d1dy9.2.
(The format of our PDB-style files is described here.)

Timeline for d1dy9.2: