| Class b: All beta proteins [48724] (174 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
| Family b.47.1.3: Viral proteases [50596] (4 proteins) beta sheet in the first domain is opened rather than forms a barrel |
| Protein Viral capsid protein [50597] (3 species) |
| Species Semliki forest virus [TaxId:11033] [50599] (2 PDB entries) |
| Domain d1vcqb_: 1vcq B: [26399] |
PDB Entry: 1vcq (more details), 3.1 Å
SCOP Domain Sequences for d1vcqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcqb_ b.47.1.3 (B:) Viral capsid protein {Semliki forest virus [TaxId: 11033]}
cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
negsrtalsvvtwnkdmvtrvtpegseew
Timeline for d1vcqb_: