SCOP 1.57: Domain d1vcqb_: 1vcq B:

Lineage for d1vcqb_ (1vcq B:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (2 proteins)

6. Protein Viral capsid protein [50597] (2 species)

7. Species Semliki forest virus [TaxId:11033] [50599] (2 PDB entries)

8. Domain d1vcqb_: 1vcq B: [26399]

Details for d1vcqb_

PDB Entry: 1vcq, 3.1 Å

PDB Description: semliki forest virus capsid protein (crystal form ii)

SCOP Domain Sequences for d1vcqb_:

Sequence; same for both SEQRES and ATOM records:

>d1vcqb_ b.47.1.3 (B:) Viral capsid protein {Semliki forest virus}
cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
negsrtalsvvtwnkdmvtrvtpegseew

Timeline for d1vcqb_:

• d1vcqb_ first appeared (with stable ids) in SCOP 1.55
  
• d1vcqb_ appears in SCOP 1.59
  
• d1vcqb_ appears in the current release, SCOPe 2.08