SCOPe 2.07: Domain d4uo5d1: 4uo5 D:1-172

Lineage for d4uo5d1 (4uo5 D:1-172)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries)

8. Domain d4uo5d1: 4uo5 D:1-172 [263985]
   Other proteins in same PDB: d4uo5a_, d4uo5b2, d4uo5c_, d4uo5d2, d4uo5e_, d4uo5f2
   automated match to d4uo4b_
   complexed with nag, so4

Details for d4uo5d1

PDB Entry: 4uo5, 2.7 Å

PDB Description: structure of the a_canine_colorado_17864_06 h3 haemagglutinin in complex with 3sln

PDB Compounds: (D:) h3 haemagglutinin ha2 chain

SCOPe Domain Sequences for d4uo5d1:

Sequence; same for both SEQRES and ATOM records:

>d4uo5d1 h.3.1.0 (D:1-172) automated matches {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfq

Timeline for d4uo5d1:

• d4uo5d1 first appeared in SCOPe 2.05, called d4uo5d_
  
• d4uo5d1 appears in SCOPe 2.06
  
• d4uo5d1 appears in the current release, SCOPe 2.08