Lineage for d4uo3b_ (4uo3 B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2645947Species Influenza A virus (a/equine/richmond/1/2007)(h3n8)) [TaxId:560387] [258556] (3 PDB entries)
  8. 2645951Domain d4uo3b_: 4uo3 B: [263981]
    Other proteins in same PDB: d4uo3a_, d4uo3c_, d4uo3e_
    automated match to d4uo1b_
    complexed with edo, nag; mutant

Details for d4uo3b_

PDB Entry: 4uo3 (more details), 2.87 Å

PDB Description: structure of the a_equine_richmond_07 h3 haemagglutinin mutant ser30thr
PDB Compounds: (B:) h3 haemagglutinin ha2 chain

SCOPe Domain Sequences for d4uo3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uo3b_ h.3.1.1 (B:) automated matches {Influenza A virus (a/equine/richmond/1/2007)(h3n8)) [TaxId: 560387]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqtaidqineklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfq

SCOPe Domain Coordinates for d4uo3b_:

Click to download the PDB-style file with coordinates for d4uo3b_.
(The format of our PDB-style files is described here.)

Timeline for d4uo3b_: