Lineage for d4unwc_ (4unw C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385678Protein automated matches [190291] (21 species)
    not a true protein
  7. 2385692Species Influenza A virus (a/eq/newmarket/93/(h3n8)) [TaxId:159470] [258548] (2 PDB entries)
  8. 2385694Domain d4unwc_: 4unw C: [263974]
    Other proteins in same PDB: d4unwb_, d4unwd_, d4unwf_
    automated match to d4unzc_
    complexed with nag

Details for d4unwc_

PDB Entry: 4unw (more details), 2.6 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin
PDB Compounds: (C:) h3 haemagglutinin ha1 chain

SCOPe Domain Sequences for d4unwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4unwc_ b.19.1.2 (C:) automated matches {Influenza A virus (a/eq/newmarket/93/(h3n8)) [TaxId: 159470]}
nntatlclghhavangtlvktitddqievtnatelvqsisigkicnnsyrvldgrnctli
damlgdphcddfqyenwdlfierssafsncypydipdyaslrsivassgtleftaegftw
tgvtqnggsgackrgsadsffsrlnwltksgnsypilnvtmpnnknfdklyiwgihhpss
nkeqtklyiqesgrvtvstersqqtvipnigsrpwvrgqsgrisiywtivkpgdilmins
ngnlvaprgyfklrtgkssvmrsdalidtcvsecitpngsipndkpfqnvnkitygkcpk
yirqntlklatgmrnvpekqi

SCOPe Domain Coordinates for d4unwc_:

Click to download the PDB-style file with coordinates for d4unwc_.
(The format of our PDB-style files is described here.)

Timeline for d4unwc_: