Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (25 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187294] (882 PDB entries) |
Domain d4un0d_: 4un0 D: [263967] Other proteins in same PDB: d4un0a1, d4un0a2, d4un0b1, d4un0b2 automated match to d4un0c_ |
PDB Entry: 4un0 (more details), 3.15 Å
SCOPe Domain Sequences for d4un0d_:
Sequence, based on SEQRES records: (download)
>d4un0d_ d.144.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} cvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireikilrqli hrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfsedhiksfmkq lmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnkvitlwyr ppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcpavwpd viklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqsdflkd ve
>d4un0d_ d.144.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} cvdkfdiigiigegtygqvykakdkdtgelvalkkvrlkegfpitaireikilrqlihrs vvnmkeivtdafylvfeymdhdlmgllhfsedhiksfmkqlmegleychkknflhrdikc snillnnsgqikladfglarlynpytnkvitlwyrppelllgeerytpaidvwscgcilg elftkkpifqanlelaqlelisrlcgspcpavwpdviklpyfntmkpkkqyrrrlreefs fipsaaldlldhmltldpskrctaeqtlqsdflkdve
Timeline for d4un0d_: