Lineage for d4un0d_ (4un0 D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (29 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1053 PDB entries)
  8. 2547714Domain d4un0d_: 4un0 D: [263967]
    Other proteins in same PDB: d4un0a1, d4un0a2, d4un0b1, d4un0b2
    automated match to d4un0c_

Details for d4un0d_

PDB Entry: 4un0 (more details), 3.15 Å

PDB Description: crystal structure of the human cdk12-cyclink complex
PDB Compounds: (D:) cyclin-dependent kinase 12

SCOPe Domain Sequences for d4un0d_:

Sequence, based on SEQRES records: (download)

>d4un0d_ d.144.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireikilrqli
hrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfsedhiksfmkq
lmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnkvitlwyr
ppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcpavwpd
viklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqsdflkd
ve

Sequence, based on observed residues (ATOM records): (download)

>d4un0d_ d.144.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cvdkfdiigiigegtygqvykakdkdtgelvalkkvrlkegfpitaireikilrqlihrs
vvnmkeivtdafylvfeymdhdlmgllhfsedhiksfmkqlmegleychkknflhrdikc
snillnnsgqikladfglarlynpytnkvitlwyrppelllgeerytpaidvwscgcilg
elftkkpifqanlelaqlelisrlcgspcpavwpdviklpyfntmkpkkqyrrrlreefs
fipsaaldlldhmltldpskrctaeqtlqsdflkdve

SCOPe Domain Coordinates for d4un0d_:

Click to download the PDB-style file with coordinates for d4un0d_.
(The format of our PDB-style files is described here.)

Timeline for d4un0d_: