Class a: All alpha proteins [46456] (290 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein automated matches [227027] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries) |
Domain d4un0b1: 4un0 B:22-157 [263965] Other proteins in same PDB: d4un0c_, d4un0d_ automated match to d2i53a1 |
PDB Entry: 4un0 (more details), 3.15 Å
SCOPe Domain Sequences for d4un0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4un0b1 a.74.1.1 (B:22-157) automated matches {Human (Homo sapiens) [TaxId: 9606]} pcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfhrf ymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkeevm vlerillqtikfdlqv
Timeline for d4un0b1:
View in 3D Domains from other chains: (mouse over for more information) d4un0a1, d4un0a2, d4un0c_, d4un0d_ |