Lineage for d4ub8x_ (4ub8 X:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2255005Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 2255006Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 2255010Protein automated matches [267680] (2 species)
    not a true protein
  7. 2255019Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (10 PDB entries)
  8. 2255026Domain d4ub8x_: 4ub8 X: [263961]
    Other proteins in same PDB: d4ub8a_, d4ub8b_, d4ub8c_, d4ub8d_, d4ub8e_, d4ub8f_, d4ub8h_, d4ub8i_, d4ub8j_, d4ub8k_, d4ub8l_, d4ub8m_, d4ub8o_, d4ub8u_, d4ub8v_, d4ub8z_
    automated match to d3a0hx_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub8x_

PDB Entry: 4ub8 (more details), 1.95 Å

PDB Description: native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
PDB Compounds: (X:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d4ub8x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ub8x_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqrs

SCOPe Domain Coordinates for d4ub8x_:

Click to download the PDB-style file with coordinates for d4ub8x_.
(The format of our PDB-style files is described here.)

Timeline for d4ub8x_: