SCOP 1.63: Domain d1vcpb_: 1vcp B:

Lineage for d1vcpb_ (1vcp B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (4 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein Viral capsid protein [50597] (2 species)

7. Species Semliki forest virus [TaxId:11033] [50599] (2 PDB entries)

8. Domain d1vcpb_: 1vcp B: [26396]

Details for d1vcpb_

PDB Entry: 1vcp, 3 Å

PDB Description: semliki forest virus capsid protein (crystal form i)

SCOP Domain Sequences for d1vcpb_:

Sequence; same for both SEQRES and ATOM records:

>d1vcpb_ b.47.1.3 (B:) Viral capsid protein {Semliki forest virus}
cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
negsrtalsvvtwnkdmvtrvtpegseew

Timeline for d1vcpb_:

• d1vcpb_ first appeared (with stable ids) in SCOP 1.55
  
• d1vcpb_ appears in SCOP 1.61
  
• d1vcpb_ appears in SCOP 1.65
  
• d1vcpb_ appears in the current release, SCOPe 2.08