SCOPe 2.07: Domain d4ub8f_: 4ub8 F:

Lineage for d4ub8f_ (4ub8 F:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267725] (12 PDB entries)

8. Domain d4ub8f_: 4ub8 F: [263958]
   Other proteins in same PDB: d4ub8a_, d4ub8b_, d4ub8c_, d4ub8d_, d4ub8e_, d4ub8h_, d4ub8i_, d4ub8j_, d4ub8k_, d4ub8l_, d4ub8m_, d4ub8o_, d4ub8u_, d4ub8v_, d4ub8x_, d4ub8z_
   automated match to d3a0hf_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub8f_

PDB Entry: 4ub8, 1.95 Å

PDB Description: native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser

PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d4ub8f_:

Sequence; same for both SEQRES and ATOM records:

>d4ub8f_ f.23.38.1 (F:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus vulcanus [TaxId: 32053]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d4ub8f_:

• d4ub8f_ first appeared in SCOPe 2.05
  
• d4ub8f_ appears in SCOPe 2.06
  
• d4ub8f_ appears in the current release, SCOPe 2.08