Lineage for d4ub8f_ (4ub8 F:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958546Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 1958547Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 1958558Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species)
  7. 1958562Species Thermosynechococcus vulcanus [TaxId:32053] [267725] (2 PDB entries)
  8. 1958563Domain d4ub8f_: 4ub8 F: [263958]
    Other proteins in same PDB: d4ub8a_, d4ub8b_, d4ub8c_, d4ub8d_, d4ub8e_, d4ub8h_, d4ub8i_, d4ub8j_, d4ub8k_, d4ub8l_, d4ub8m_, d4ub8o_, d4ub8u_, d4ub8v_, d4ub8x_, d4ub8z_
    automated match to d3a0hf_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub8f_

PDB Entry: 4ub8 (more details), 1.95 Å

PDB Description: native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d4ub8f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ub8f_ f.23.38.1 (F:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus vulcanus [TaxId: 32053]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d4ub8f_:

Click to download the PDB-style file with coordinates for d4ub8f_.
(The format of our PDB-style files is described here.)

Timeline for d4ub8f_: