SCOPe 2.06: Domain d4u4ld_: 4u4l D:

Lineage for d4u4ld_ (4u4l D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (18 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (37 PDB entries)

8. Domain d4u4ld_: 4u4l D: [263954]
   automated match to d4eyba_
   complexed with 3c7, gol, zn

Details for d4u4ld_

PDB Entry: 4u4l, 1.9 Å

PDB Description: Crystal structure of the metallo-beta-lactamase NDM-1 in complex with a bisthiazolidine inhibitor

PDB Compounds: (D:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4u4ld_:

Sequence, based on SEQRES records:

>d4u4ld_ d.157.1.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
tgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaq
ilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhs
ltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgn
lgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Sequence, based on observed residues (ATOM records):

>d4u4ld_ d.157.1.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
tgdqrfgdlvfrqlapnvwqhtsyldvasnglivrdggrvlvvdtawtddqtaqilnwik
qeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfaan
gwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgdadt
ehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Timeline for d4u4ld_:

• d4u4ld_ first appeared in SCOPe 2.05
  
• d4u4ld_ appears in SCOPe 2.07
  
• d4u4ld_ appears in the current release, SCOPe 2.08