Class b: All beta proteins [48724] (141 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.3: Viral proteases [50596] (4 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein Viral capsid protein [50597] (3 species) |
Species Semliki forest virus [TaxId:11033] [50599] (2 PDB entries) |
Domain d1vcpa_: 1vcp A: [26395] |
PDB Entry: 1vcp (more details), 3 Å
SCOP Domain Sequences for d1vcpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus} cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga negsrtalsvvtwnkdmvtrvtpegseew
Timeline for d1vcpa_: