Lineage for d2snv__ (2snv -)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298675Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 298676Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 299596Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 299634Protein Viral capsid protein [50597] (3 species)
  7. 299641Species Sindbis virus [TaxId:11034] [50598] (10 PDB entries)
  8. 299656Domain d2snv__: 2snv - [26394]

Details for d2snv__

PDB Entry: 2snv (more details), 2.8 Å

PDB Description: the refined structure of sindbis virus core protein in comparison with other chymotrypsin-like serine proteinase structures

SCOP Domain Sequences for d2snv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2snv__ b.47.1.3 (-) Viral capsid protein {Sindbis virus}
rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
adegtrtalsvvtwnskgktikttpegteew

SCOP Domain Coordinates for d2snv__:

Click to download the PDB-style file with coordinates for d2snv__.
(The format of our PDB-style files is described here.)

Timeline for d2snv__: