Lineage for d1kxea_ (1kxe A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797067Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2797123Protein Viral capsid protein [50597] (3 species)
  7. 2797130Species Sindbis virus [TaxId:11034] [50598] (11 PDB entries)
  8. 2797143Domain d1kxea_: 1kxe A: [26393]
    mutant

Details for d1kxea_

PDB Entry: 1kxe (more details), 3.2 Å

PDB Description: sindbis virus capsid (y180s, e183g double mutant), tetragonal crystal form
PDB Compounds: (A:) sindbis virus capsid protein

SCOPe Domain Sequences for d1kxea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxea_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]}
lkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefa
qlpvnmrseaftstsghpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvv
aivlggadegtrtalsvvtwnskgktikttpegteew

SCOPe Domain Coordinates for d1kxea_:

Click to download the PDB-style file with coordinates for d1kxea_.
(The format of our PDB-style files is described here.)

Timeline for d1kxea_: