Lineage for d1kxd__ (1kxd -)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 376039Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 376040Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 377097Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 377137Protein Viral capsid protein [50597] (3 species)
  7. 377144Species Sindbis virus [TaxId:11034] [50598] (10 PDB entries)
  8. 377157Domain d1kxd__: 1kxd - [26392]
    mutant

Details for d1kxd__

PDB Entry: 1kxd (more details), 3.1 Å

PDB Description: sindbis virus capsid (n222l mutant), tetragonal crystal form

SCOP Domain Sequences for d1kxd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxd__ b.47.1.3 (-) Viral capsid protein {Sindbis virus}
alkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmef
aqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdlsgrv
vaivlggadegtrtalsvvtwnskgktikttpegteew

SCOP Domain Coordinates for d1kxd__:

Click to download the PDB-style file with coordinates for d1kxd__.
(The format of our PDB-style files is described here.)

Timeline for d1kxd__: