Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) consists of single alpha-helix and irregular N-terminal tail automatically mapped to Pfam PF02315 |
Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins) |
Protein automated matches [190583] (2 species) not a true protein |
Species Methylococcus capsulatus [TaxId:243233] [260039] (1 PDB entry) |
Domain d4tqon_: 4tqo N: [263915] Other proteins in same PDB: d4tqoa_, d4tqob_, d4tqoc_, d4tqod_, d4tqoe_, d4tqof_, d4tqog_, d4tqoh_ automated match to d4tqop_ complexed with ca, pqq |
PDB Entry: 4tqo (more details), 2.57 Å
SCOPe Domain Sequences for d4tqon_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tqon_ a.137.2.1 (N:) automated matches {Methylococcus capsulatus [TaxId: 243233]} ydgthckapgncwepkpgypdkvagskydpkhdpnelnkqaesikamearnqkrvenyak tgkfvykvedik
Timeline for d4tqon_: