SCOPe 2.05: Domain d4rnlc_: 4rnl C:

Lineage for d4rnlc_ (4rnl C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.0: automated matches [227145] (1 protein)
   not a true family

6. Protein automated matches [226849] (5 species)
   not a true protein

7. Species Streptomyces platensis [TaxId:58346] [261282] (1 PDB entry)

8. Domain d4rnlc_: 4rnl C: [263888]
   automated match to d4rnlb_
   complexed with gol, po4

Details for d4rnlc_

PDB Entry: 4rnl, 1.8 Å

PDB Description: the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus

PDB Compounds: (C:) possible galactose mutarotase

SCOPe Domain Sequences for d4rnlc_:

Sequence; same for both SEQRES and ATOM records:

>d4rnlc_ b.30.5.0 (C:) automated matches {Streptomyces platensis [TaxId: 58346]}
amrtqvsrepfgtlddgtrvdrwtlesgpaglrvrvltyggivqtveapdrdgmrgqlal
gfadlasyaahggsyfgalvgryanriagasfvldgrtdaltpnngrhslhggpggfsrv
vwdarevdggvqlhrvspdgeegfpgaldvrvtytlsagalrivscattdaptvvnltnh
tylnlggdgsgsaaghelrlaasrytpvdgtgipvpgapaevtgtrfdfraaravagayd
hnfaldggvreaprtvaelydprsgralalattepglqlytadhldgtltgtsgvpygpa
aglaletqhfpdspnrpdfpstvlrpgesyrsetvyafsvr

Timeline for d4rnlc_:

• d4rnlc_ is new in SCOPe 2.05-stable
  
• d4rnlc_ appears in SCOPe 2.06
  
• d4rnlc_ appears in the current release, SCOPe 2.08