Class b: All beta proteins [48724] (119 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.3: Viral proteases [50596] (4 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein Viral capsid protein [50597] (2 species) |
Species Sindbis virus [TaxId:11034] [50598] (10 PDB entries) |
Domain d1wykc_: 1wyk C: [26388] |
PDB Entry: 1wyk (more details), 2 Å
SCOP Domain Sequences for d1wykc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wykc_ b.47.1.3 (C:) Viral capsid protein {Sindbis virus} xmrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpv nmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivl ggadegtrtalsvvtwnskgktikttpegteew
Timeline for d1wykc_: