Lineage for d1wykb_ (1wyk B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 803501Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 803556Protein Viral capsid protein [50597] (3 species)
  7. 803563Species Sindbis virus [TaxId:11034] [50598] (11 PDB entries)
  8. 803565Domain d1wykb_: 1wyk B: [26387]

Details for d1wykb_

PDB Entry: 1wyk (more details), 2 Å

PDB Description: sindbis virus capsid protein (114-264)
PDB Compounds: (B:) sindbis virus capsid protein

SCOP Domain Sequences for d1wykb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wykb_ b.47.1.3 (B:) Viral capsid protein {Sindbis virus [TaxId: 11034]}
mrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvn
mrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlg
gadegtrtalsvvtwnskgktikttpegteew

SCOP Domain Coordinates for d1wykb_:

Click to download the PDB-style file with coordinates for d1wykb_.
(The format of our PDB-style files is described here.)

Timeline for d1wykb_: