Lineage for d1kxaa_ (1kxa A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 671537Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 671589Protein Viral capsid protein [50597] (3 species)
  7. 671596Species Sindbis virus [TaxId:11034] [50598] (11 PDB entries)
  8. 671607Domain d1kxaa_: 1kxa A: [26383]

Details for d1kxaa_

PDB Entry: 1kxa (more details), 3.1 Å

PDB Description: sindbis virus capsid, (wild-type) residues 106-264, tetragonal crystal form
PDB Compounds: (A:) sindbis virus capsid protein

SCOP Domain Sequences for d1kxaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxaa_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]}
alkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmef
aqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrv
vaivlggadegtrtalsvvtwnskgktikttpegteew

SCOP Domain Coordinates for d1kxaa_:

Click to download the PDB-style file with coordinates for d1kxaa_.
(The format of our PDB-style files is described here.)

Timeline for d1kxaa_: