SCOP 1.61: Domain d2snwb_: 2snw B:

Lineage for d2snwb_ (2snw B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (2 proteins)

6. Protein Viral capsid protein [50597] (2 species)

7. Species Sindbis virus [TaxId:11034] [50598] (10 PDB entries)

8. Domain d2snwb_: 2snw B: [26382]

Details for d2snwb_

PDB Entry: 2snw, 2.7 Å

PDB Description: sindbis virus capsid protein, type3 crystal form

SCOP Domain Sequences for d2snwb_:

Sequence; same for both SEQRES and ATOM records:

>d2snwb_ b.47.1.3 (B:) Viral capsid protein {Sindbis virus}
alkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmef
aqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrv
vaivlggadegtrtalsvvtwnskgktikttpegteew

Timeline for d2snwb_:

• d2snwb_ first appeared (with stable ids) in SCOP 1.55
  
• d2snwb_ appears in SCOP 1.59
  
• d2snwb_ appears in SCOP 1.63
  
• d2snwb_ appears in the current release, SCOPe 2.08