SCOP 1.73: Domain d1kxfa_: 1kxf A:

Lineage for d1kxfa_ (1kxf A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (4 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein Viral capsid protein [50597] (3 species)

7. Species Sindbis virus [TaxId:11034] [50598] (11 PDB entries)

8. Domain d1kxfa_: 1kxf A: [26380]

Details for d1kxfa_

PDB Entry: 1kxf, 2.38 Å

PDB Description: sindbis virus capsid, (wild-type) residues 1-264, tetragonal crystal form (form ii)

PDB Compounds: (A:) sindbis virus capsid protein

SCOP Domain Sequences for d1kxfa_:

Sequence; same for both SEQRES and ATOM records:

>d1kxfa_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]}
malkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydme
faqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgr
vvaivlggadegtrtalsvvtwnskgktikttpegteew

Timeline for d1kxfa_:

• d1kxfa_ first appeared (with stable ids) in SCOP 1.55, called d1kxf__
  
• d1kxfa_ was called d1kxf__ in SCOP 1.71
  
• d1kxfa_ appears in SCOP 1.75
  
• d1kxfa_ appears in the current release, SCOPe 2.08