Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (38 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [259286] (5 PDB entries) |
Domain d4qyic_: 4qyi C: [263784] automated match to d4rqba_ complexed with epe, gol, mg, po4 |
PDB Entry: 4qyi (more details), 1.95 Å
SCOPe Domain Sequences for d4qyic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qyic_ c.61.1.0 (C:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} ieikdtliseeqlqekvkelalqierdfegeeivviavlkgsfvfaadlirhikndvtid fisassygnqtettgkvkllkdidvnitgknvivvediidsgltlhflkdhffmhkpkal kfctlldkperrkvdltaeyvgfqipdefivgygidcaekyrnlpfiasvv
Timeline for d4qyic_:
View in 3D Domains from other chains: (mouse over for more information) d4qyia_, d4qyib_, d4qyid_, d4qyie_ |