Lineage for d4qyic_ (4qyi C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2891863Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [259286] (5 PDB entries)
  8. 2891868Domain d4qyic_: 4qyi C: [263784]
    automated match to d4rqba_
    complexed with epe, gol, mg, po4

Details for d4qyic_

PDB Entry: 4qyi (more details), 1.95 Å

PDB Description: 1.95 angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from bacillus anthracis str. 'ames ancestor' with hepes molecule in the active site
PDB Compounds: (C:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4qyic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qyic_ c.61.1.0 (C:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ieikdtliseeqlqekvkelalqierdfegeeivviavlkgsfvfaadlirhikndvtid
fisassygnqtettgkvkllkdidvnitgknvivvediidsgltlhflkdhffmhkpkal
kfctlldkperrkvdltaeyvgfqipdefivgygidcaekyrnlpfiasvv

SCOPe Domain Coordinates for d4qyic_:

Click to download the PDB-style file with coordinates for d4qyic_.
(The format of our PDB-style files is described here.)

Timeline for d4qyic_: