SCOPe 2.06: Domain d4qnsd_: 4qns D:

Lineage for d4qnsd_ (4qns D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (10 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [237857] (3 PDB entries)

8. Domain d4qnsd_: 4qns D: [263775]
   Other proteins in same PDB: d4qnsa2, d4qnsb2
   automated match to d4qnsa_
   complexed with act, edo, so4

Details for d4qnsd_

PDB Entry: 4qns, 1.5 Å

PDB Description: crystal structure of bromodomain from plasmodium faciparum gcn5, pf3d7_0823300

PDB Compounds: (D:) Histone acetyltransferase GCN5, putative

SCOPe Domain Sequences for d4qnsd_:

Sequence; same for both SEQRES and ATOM records:

>d4qnsd_ a.29.2.0 (D:) automated matches {Plasmodium falciparum [TaxId: 36329]}
vqlkdqilgvldylekqqsawpflkpvslseapdyydiikeptdiltmrrkarhgdyktk
edfgielkrmfdncrlynapttiyfkyanelqtliwpkyeai

Timeline for d4qnsd_:

• d4qnsd_ first appeared in SCOPe 2.05
  
• d4qnsd_ appears in SCOPe 2.07
  
• d4qnsd_ appears in the current release, SCOPe 2.08