Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (15 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [237857] (4 PDB entries) |
Domain d4qnsc_: 4qns C: [263774] Other proteins in same PDB: d4qnsa2, d4qnsb2 automated match to d4qnsa_ complexed with act, edo, so4 |
PDB Entry: 4qns (more details), 1.5 Å
SCOPe Domain Sequences for d4qnsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qnsc_ a.29.2.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]} qlkdqilgvldylekqqsawpflkpvslseapdyydiikeptdiltmrrkarhgdyktke dfgielkrmfdncrlynapttiyfkyanelqtliwpkyeai
Timeline for d4qnsc_: