Lineage for d4qlvp_ (4qlv P:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994147Domain d4qlvp_: 4qlv P: [263760]
    Other proteins in same PDB: d4qlva_, d4qlvb_, d4qlvc2, d4qlve_, d4qlvg_, d4qlvi_, d4qlvj_, d4qlvk_, d4qlvl_, d4qlvn_, d4qlvo_, d4qlvq2, d4qlvs_, d4qlvu_, d4qlvw_, d4qlvx_, d4qlvy_, d4qlvz_
    automated match to d1rypc_
    complexed with 39q, mes, mg

Details for d4qlvp_

PDB Entry: 4qlv (more details), 2.9 Å

PDB Description: yCP in complex with tripeptidic epoxyketone inhibitor 17
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qlvp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qlvp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4qlvp_:

Click to download the PDB-style file with coordinates for d4qlvp_.
(The format of our PDB-style files is described here.)

Timeline for d4qlvp_: