SCOPe 2.08: Domain d4qlup_: 4qlu P:

Lineage for d4qlup_ (4qlu P:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d4qlup_: 4qlu P: [263752]
   Other proteins in same PDB: d4qlua_, d4qlub_, d4qluc2, d4qlue_, d4qlug_, d4qlui_, d4qluj_, d4qluk_, d4qlul_, d4qlun_, d4qluo_, d4qluq2, d4qlus_, d4qluu_, d4qluw_, d4qlux_, d4qluy_, d4qluz_
   automated match to d1rypc_
   complexed with 38x, mes, mg

Details for d4qlup_

PDB Entry: 4qlu, 2.8 Å

PDB Description: yCP in complex with tripeptidic epoxyketone inhibitor 9

PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qlup_:

Sequence; same for both SEQRES and ATOM records:

>d4qlup_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

Timeline for d4qlup_:

• d4qlup_ first appeared in SCOPe 2.05
  
• d4qlup_ appears in SCOPe 2.07