Lineage for d4qlsv_ (4qls V:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries)
  8. 1936780Domain d4qlsv_: 4qls V: [263744]
    Other proteins in same PDB: d4qlsa_, d4qlsb_, d4qlse_, d4qlsg_, d4qlsi_, d4qlsj_, d4qlsk_, d4qlsl_, d4qlsn_, d4qlso_, d4qlss_, d4qlsu_, d4qlsw_, d4qlsx_, d4qlsy_, d4qlsz_
    automated match to d4r17h_
    complexed with 37y, mes, mg

Details for d4qlsv_

PDB Entry: 4qls (more details), 2.8 Å

PDB Description: yCP in complex with tripeptidic epoxyketone inhibitor 11
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4qlsv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qlsv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d4qlsv_:

Click to download the PDB-style file with coordinates for d4qlsv_.
(The format of our PDB-style files is described here.)

Timeline for d4qlsv_: