SCOPe 2.08: Domain d4qlsm_: 4qls M:

Lineage for d4qlsm_ (4qls M:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d4qlsm_: 4qls M: [263740]
   Other proteins in same PDB: d4qlsa_, d4qlsb_, d4qlsc2, d4qlse_, d4qlsg_, d4qlsi_, d4qlsj_, d4qlsk_, d4qlsl_, d4qlsn_, d4qlso_, d4qlsq2, d4qlss_, d4qlsu_, d4qlsw_, d4qlsx_, d4qlsy_, d4qlsz_
   automated match to d4j70m_
   complexed with 37y, mes, mg

Details for d4qlsm_

PDB Entry: 4qls, 2.8 Å

PDB Description: ycp in complex with tripeptidic epoxyketone inhibitor 11

PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d4qlsm_:

Sequence; same for both SEQRES and ATOM records:

>d4qlsm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

Timeline for d4qlsm_:

• d4qlsm_ first appeared in SCOPe 2.05
  
• d4qlsm_ appears in SCOPe 2.07