Lineage for d4qlqt_ (4qlq T:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (197 PDB entries)
  8. 2553019Domain d4qlqt_: 4qlq T: [263735]
    Other proteins in same PDB: d4qlqa_, d4qlqb_, d4qlqe_, d4qlqg_, d4qlqi_, d4qlqj_, d4qlqk_, d4qlql_, d4qlqn_, d4qlqo_, d4qlqs_, d4qlqu_, d4qlqw_, d4qlqx_, d4qlqy_, d4qlqz_
    automated match to d4g4sg_
    complexed with 38n, mes, mg

Details for d4qlqt_

PDB Entry: 4qlq (more details), 2.4 Å

PDB Description: yCP in complex with tripeptidic epoxyketone inhibitor 8
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qlqt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qlqt_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4qlqt_:

Click to download the PDB-style file with coordinates for d4qlqt_.
(The format of our PDB-style files is described here.)

Timeline for d4qlqt_: