Lineage for d4qlqm_ (4qlq M:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries)
  8. 1936712Domain d4qlqm_: 4qlq M: [263732]
    Other proteins in same PDB: d4qlqa_, d4qlqb_, d4qlqe_, d4qlqg_, d4qlqi_, d4qlqj_, d4qlqk_, d4qlql_, d4qlqn_, d4qlqo_, d4qlqs_, d4qlqu_, d4qlqw_, d4qlqx_, d4qlqy_, d4qlqz_
    automated match to d4j70m_
    complexed with 38n, mes, mg

Details for d4qlqm_

PDB Entry: 4qlq (more details), 2.4 Å

PDB Description: yCP in complex with tripeptidic epoxyketone inhibitor 8
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d4qlqm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qlqm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d4qlqm_:

Click to download the PDB-style file with coordinates for d4qlqm_.
(The format of our PDB-style files is described here.)

Timeline for d4qlqm_: