Lineage for d4ql5b_ (4ql5 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2790168Protein automated matches [190915] (12 species)
    not a true protein
  7. 2790192Species Streptococcus pneumoniae [TaxId:170187] [258407] (1 PDB entry)
  8. 2790194Domain d4ql5b_: 4ql5 B: [263727]
    automated match to d1ah9a_
    complexed with act, gol, zn

Details for d4ql5b_

PDB Entry: 4ql5 (more details), 2.02 Å

PDB Description: Crystal structure of translation initiation factor IF-1 from Streptococcus pneumoniae TIGR4
PDB Compounds: (B:) Translation initiation factor IF-1

SCOPe Domain Sequences for d4ql5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ql5b_ b.40.4.5 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
ievegkvvdtmpnamftvelenghqilatvsgkirknyirilagdrvtvemspydltrgr
ityrfk

SCOPe Domain Coordinates for d4ql5b_:

Click to download the PDB-style file with coordinates for d4ql5b_.
(The format of our PDB-style files is described here.)

Timeline for d4ql5b_: