Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein automated matches [190915] (12 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:170187] [258407] (1 PDB entry) |
Domain d4ql5b_: 4ql5 B: [263727] automated match to d1ah9a_ complexed with act, gol, zn |
PDB Entry: 4ql5 (more details), 2.02 Å
SCOPe Domain Sequences for d4ql5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ql5b_ b.40.4.5 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]} ievegkvvdtmpnamftvelenghqilatvsgkirknyirilagdrvtvemspydltrgr ityrfk
Timeline for d4ql5b_: