SCOPe 2.08: Domain d4qkub1: 4qku B:6-133

Lineage for d4qkub1 (4qku B:6-133)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (2 families)
   automatically mapped to Pfam PF09298

5. Family b.34.8.0: automated matches [257687] (1 protein)
   not a true family

6. Protein automated matches [257688] (2 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [257689] (1 PDB entry)

8. Domain d4qkub1: 4qku B:6-133 [263721]
   Other proteins in same PDB: d4qkua2, d4qkub2, d4qkuc2, d4qkud2
   automated match to d4qkua1
   complexed with edo, na, so4

Details for d4qkub1

PDB Entry: 4qku, 2.45 Å

PDB Description: Crystal structure of a putative hydrolase from Burkholderia cenocepacia

PDB Compounds: (B:) hydrolase

SCOPe Domain Sequences for d4qkub1:

Sequence; same for both SEQRES and ATOM records:

>d4qkub1 b.34.8.0 (B:6-133) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
dwratldparkswietandpacdfpiqnlpfgifsdakgarrpgvalgdqivdlaalara
glvtlpagadvlaaptlnafialgrdawrsvrvqlsalfsrddatlrddaalraqvlvaq
rdatlhlp

Timeline for d4qkub1:

• d4qkub1 first appeared in SCOPe 2.05
  
• d4qkub1 appears in SCOPe 2.07