Lineage for d4qjed_ (4qje D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1875571Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 1875572Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 1875981Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 1875982Protein automated matches [190683] (38 species)
    not a true protein
  7. 1876546Species Staphylococcus aureus [TaxId:93062] [225575] (11 PDB entries)
  8. 1876564Domain d4qjed_: 4qje D: [263719]
    automated match to d4qn2a_
    complexed with b3p, na, peg, trs; mutant

Details for d4qjed_

PDB Entry: 4qje (more details), 1.85 Å

PDB Description: 1.85 angstrom resolution crystal structure of apo betaine aldehyde dehydrogenase (betb) g234s mutant from staphylococcus aureus (idp00699) with bme-free sulfinic acid form of cys289
PDB Compounds: (D:) betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d4qjed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qjed_ c.82.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mellkhlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerailaarrafe
sgewsqetaetrgkkvraiadkikehrealarletldtgktleesyadmddihnvfmyfa
gladkdggemidspipdteskivkepvgvvtqitpwnypllqaswkiapalatgcslvmk
pseitplttirvfelmeevgfpkgtinlilgagsevgdvmsghkevdlvsftgsietgkh
imknaannvtnialelggknpniifddadfelavdqalnggyfhagqvcsagsrilvqns
ikdkfeqalidrvkkiklgngfdadtemgpvistehrnkiesymdvakaegatiavggkr
pdrddlkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqlandsiyglag
avfskdigkaqrvanklklgtvwindfhpyfaqapwggykqsgigrelgkegleeylvsk
hiltntnpqlvnwfsk

SCOPe Domain Coordinates for d4qjed_:

Click to download the PDB-style file with coordinates for d4qjed_.
(The format of our PDB-style files is described here.)

Timeline for d4qjed_: