Lineage for d4qgrb1 (4qgr B:1-372)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504479Species Brucella abortus [TaxId:359391] [257681] (1 PDB entry)
  8. 2504481Domain d4qgrb1: 4qgr B:1-372 [263703]
    Other proteins in same PDB: d4qgra2, d4qgrb2
    automated match to d4qgra_
    complexed with act, mg, plp

Details for d4qgrb1

PDB Entry: 4qgr (more details), 1.75 Å

PDB Description: Crystal structure of a DegT DnrJ EryC1 StrS aminotransferase from Brucella abortus
PDB Compounds: (B:) DegT/DnrJ/EryC1/StrS aminotransferase

SCOPe Domain Sequences for d4qgrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qgrb1 c.67.1.0 (B:1-372) automated matches {Brucella abortus [TaxId: 359391]}
mqfidlgaqrarienrlnaaiskvvaegryilgpevaefekklgeylgvehviacangtd
alqmplmtrgigpghavfvpsftfaataevvalvgaepvfvdvdpdsynmnveqleaaia
atikegrlepkaiipvdlfglaasynritaiaereglfiiedaaqsiggkrdnvmcgafg
hvgatsfypakplgcygdggamftndaeladtlrsvlfhgkgetqydnvriginsrldti
qaavlleklailedemeardriarrynealkdvvkvpelpagnrsawaqysiesenrdgl
kaqlqaegipsviyyvkplhlqtaykhysvapgglpvseslpsrilslpmhpylseadqd
kiigvirgfhgk

SCOPe Domain Coordinates for d4qgrb1:

Click to download the PDB-style file with coordinates for d4qgrb1.
(The format of our PDB-style files is described here.)

Timeline for d4qgrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qgrb2