Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [196398] (6 PDB entries) |
Domain d4qfed_: 4qfe D: [263687] Other proteins in same PDB: d4qfea2, d4qfee2 automated match to d4qfea_ complexed with edo, eoh, na, po4 |
PDB Entry: 4qfe (more details), 1.95 Å
SCOPe Domain Sequences for d4qfed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qfed_ c.14.1.0 (D:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} sepvrierngpvttviidrpearnavngptaaalfaafeefdaddtasvavltgangtfc agadlkafgtpeanqvhregpgpmgpsrmdlskpviaaisgyavagglelalwcdlrvvd edatmgvfcrrwgvplidggtvrlprlighsramdliltgravdaaeayaiglanrvvpt gqarqaaeelaadlarlpqqcmradrlsalhqwgesenaamdfefasisr
Timeline for d4qfed_: