SCOPe 2.05: Domain d4qezc_: 4qez C:

Lineage for d4qezc_ (4qez C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (36 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [257666] (1 PDB entry)

8. Domain d4qezc_: 4qez C: [263680]
   automated match to d3dp9c_
   complexed with ade, trs

Details for d4qezc_

PDB Entry: 4qez, 2.7 Å

PDB Description: crystal structure of 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase from bacillus anthracis

PDB Compounds: (C:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d4qezc_:

Sequence, based on SEQRES records:

>d4qezc_ c.56.2.0 (C:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
riavigameeevrilrdkleqaetetvagceftkgqlaghevillksgigkvnaamstti
llerykpekvintgsaggfhhslnvgdvvistevrhhdvdvtafnyeygqvpgmppgfka
dealvalaekcmqaeeniqvvkgmiatgdsfmsdpnrvaairdkfenlyavemeaaavaq
vchqyevpfviiralsdiagkesnvsfdqfldqaalhstnfivkvleelklehhhh

Sequence, based on observed residues (ATOM records):

>d4qezc_ c.56.2.0 (C:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
riavigameeevrilrdkleqaetetvagceftkgqlaghevillksgigkvnaamstti
llerykpekvintgsaggfhhslnvgdvvistevrhhdvdvtafnyeygqvpgmppgfka
dealvalaekcmqqvvkgmiatgdsfmsdpnrvaairdkfenlyavemeaaavaqvchqy
evpfviiralsdiagkesnvsfdqfldqaalhstnfivkvleelklehhhh

Timeline for d4qezc_:

• d4qezc_ is new in SCOPe 2.05-stable
  
• d4qezc_ is called d4qezc1 in SCOPe 2.06
  
• d4qezc_ appears in the current release, SCOPe 2.08, called d4qezc1