Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
Protein automated matches [190781] (46 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [257666] (1 PDB entry) |
Domain d4qezb1: 4qez B:2-231 [263679] Other proteins in same PDB: d4qezb2, d4qezc2 automated match to d3dp9c_ complexed with ade, trs |
PDB Entry: 4qez (more details), 2.7 Å
SCOPe Domain Sequences for d4qezb1:
Sequence, based on SEQRES records: (download)
>d4qezb1 c.56.2.0 (B:2-231) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} riavigameeevrilrdkleqaetetvagceftkgqlaghevillksgigkvnaamstti llerykpekvintgsaggfhhslnvgdvvistevrhhdvdvtafnyeygqvpgmppgfka dealvalaekcmqaeeniqvvkgmiatgdsfmsdpnrvaairdkfenlyavemeaaavaq vchqyevpfviiralsdiagkesnvsfdqfldqaalhstnfivkvleelk
>d4qezb1 c.56.2.0 (B:2-231) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} riavigameeevrilrdkleqaetetvagceftkgqlaghevillksgigkvnaamstti llerykpekvintgsaggfhhslnvgdvvistevrhhdvdvtafnyeygqvpgmppgfka dealvalaekcmqqvvkgmiatgdsfmsdpnrvaairdkfenlyavemeaaavaqvchqy evpfviiralsdiagkesnvsfdqfldqaalhstnfivkvleelk
Timeline for d4qezb1: