Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.2: FMDV leader protease [54037] (2 proteins) automatically mapped to Pfam PF05408 |
Protein automated matches [254558] (3 species) not a true protein |
Species Foot-and-mouth disease virus [TaxId:73482] [260753] (1 PDB entry) |
Domain d4qbbb_: 4qbb B: [263671] automated match to d1qola_ complexed with e69, k, po4 |
PDB Entry: 4qbb (more details), 1.6 Å
SCOPe Domain Sequences for d4qbbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qbbb_ d.3.1.2 (B:) automated matches {Foot-and-mouth disease virus [TaxId: 73482]} meltlyngekktfysrpnnhdncwlnailqlfryveepffdwvysspenltleaikqled ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh avfacvtsngwyaiddedfypwtpdpsdvlvfvpyd
Timeline for d4qbbb_: