SCOPe 2.08: Domain d4qacg1: 4qac G:1-205

Lineage for d4qacg1 (4qac G:1-205)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)

8. Domain d4qacg1: 4qac G:1-205 [263665]
   Other proteins in same PDB: d4qaca2, d4qacb2, d4qacc2, d4qacd2, d4qace2, d4qacf2, d4qacg2, d4qach2, d4qaci2, d4qacj2
   automated match to d4alxa_
   complexed with kk3, nag, po4

Details for d4qacg1

PDB Entry: 4qac, 2.1 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp) in complex with 4-(4-methylpiperidin-1-yl)-6-(4-(trifluoromethyl)phenyl) pyrimidin-2-amine

PDB Compounds: (G:) acetylcholine-binding protein

SCOPe Domain Sequences for d4qacg1:

Sequence, based on SEQRES records:

>d4qacg1 b.96.1.1 (G:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records):

>d4qacg1 b.96.1.1 (G:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptddseyfsqysrfeildvtqkknsvt
ysccpeayedvevslnfrkkg

Timeline for d4qacg1:

• d4qacg1 first appeared in SCOPe 2.05, called d4qacg_
  
• d4qacg1 appears in SCOPe 2.07