Lineage for d4q31g_ (4q31 G:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505032Species Micromonospora echinospora [TaxId:1877] [257603] (4 PDB entries)
  8. 2505055Domain d4q31g_: 4q31 G: [263626]
    automated match to d1ukja_
    complexed with cl, fmt, gol, mes

Details for d4q31g_

PDB Entry: 4q31 (more details), 2.1 Å

PDB Description: the crystal structure of cystathione gamma lyase (cale6) from micromonospora echinospora
PDB Compounds: (G:) cystathione gamma lyase CalE6

SCOPe Domain Sequences for d4q31g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q31g_ c.67.1.0 (G:) automated matches {Micromonospora echinospora [TaxId: 1877]}
gmrfgtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleecla
glerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvryadl
ttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlqq
plalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvrr
glhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsfd
ylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirlsvg
iedpqdlaedlsralagg

SCOPe Domain Coordinates for d4q31g_:

Click to download the PDB-style file with coordinates for d4q31g_.
(The format of our PDB-style files is described here.)

Timeline for d4q31g_: